PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009768414.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 534aa    MW: 60368.1 Da    PI: 5.1573
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009768414.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS332.95.8e-1021525271374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar..svselykalppsetseknsseelaalklfsevsPilkf 93 
                     lv+lLl+cAeav  +d++l ++lL+++   ++p gd++qR+  +f+ +L++rl+   + ++  ++l   + + ++ +e+  a++ +++++P++ f
  XP_009768414.1 152 LVHLLLACAEAVGCRDTRLSDSLLTQIWPAVTPFGDSLQRVSYCFALGLQSRLMLlqHRNNAGATLIQDQLAASSRAEKREAYHWLHQITPYMAF 246
                     68**************************************************98732445556666667777777999999************** PP

            GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egpp.slRiTgvgspesgskeelee.tgerLakfAeel..gvpfefnvlva 183
                     ++++aN aI +a  g+e++HiiD+++ + +QW +++++L+++p ++pp  +RiTg+ + +++   ele  +++ + ++A++    +++ef+v+ +
  XP_009768414.1 247 GFMAANDAICKASRGKECLHIIDLGMLHIFQWQSIIRTLTAQPdSPPPrLVRITGILEDTHD-FMELELgLKSLMDEVAATSsgSIRLEFQVIKE 340
                     *******************************************55555689*******6655.44444315555666665432279*****9844 PP

            GRAS 184 k.rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpr 277
                       + + ++ e+L+v++gEal+Vn+v+qlh+ ++es  + +   ++L+++k+l P +v+vveq+a+hn++ Fl rfle+l+yysa+fdslea+lpr
  XP_009768414.1 341 PvSASLFTREKLDVREGEALIVNSVMQLHKYVKESRGSLK---TILQAIKKLGPALVTVVEQDANHNGPFFLGRFLESLHYYSAIFDSLEASLPR 432
                     3588999*************************88777666...9*************************************************** PP

            GRAS 278 eseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSa 372
                     +s +rik+E+   ++ei+n+va eg++r+erhe++ +Wr++l++aGF+ v l+   ++qa+++l+ ++sdgy++ +e+g+l+lgWk+rp++++Sa
  XP_009768414.1 433 DSTTRIKIEKCHYAEEIRNIVAYEGSNRIERHERVDQWRKQLGRAGFQVVGLK--CMSQARMMLSVYGSDGYTLANEKGCLLLGWKGRPIMFASA 525
                     **************************************************995..89************************************** PP

            GRAS 373 Wr 374
                     W+
  XP_009768414.1 526 WE 527
                     *5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098549.596126509IPR005202Transcription factor GRAS
PfamPF035142.0E-99152527IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 534 aa     Download sequence    Send to blast
MHEMNSDWVL SFQSHNQDFA IRQFCAAARM NDQQQQQQHY SQNSISELYT YTSTPDHSAS  60
SQEEQEFVDS FFNIDSYDKD PLDHQVNLDN EEFGGFTSMI LNEYSYENLS LLTDEEPRYT  120
VLEACSSSDD LTGAETISHD HVEAEVDQGL QLVHLLLACA EAVGCRDTRL SDSLLTQIWP  180
AVTPFGDSLQ RVSYCFALGL QSRLMLLQHR NNAGATLIQD QLAASSRAEK REAYHWLHQI  240
TPYMAFGFMA ANDAICKASR GKECLHIIDL GMLHIFQWQS IIRTLTAQPD SPPPRLVRIT  300
GILEDTHDFM ELELGLKSLM DEVAATSSGS IRLEFQVIKE PVSASLFTRE KLDVREGEAL  360
IVNSVMQLHK YVKESRGSLK TILQAIKKLG PALVTVVEQD ANHNGPFFLG RFLESLHYYS  420
AIFDSLEASL PRDSTTRIKI EKCHYAEEIR NIVAYEGSNR IERHERVDQW RKQLGRAGFQ  480
VVGLKCMSQA RMMLSVYGSD GYTLANEKGC LLLGWKGRPI MFASAWEVHN VASS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-401525264374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009768414.10.0PREDICTED: DELLA protein RGL1-like
RefseqXP_016464602.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLW9QHI80.0W9QHI8_9R
STRINGVIT_19s0085g00540.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA140671113
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.12e-76RGA-like 1